6XNBA

The crystal structure of the s154y mutant carbonyl reductase from leifsonia xyli explains enhanced activity for 3,5-bis(trifluoromethyl)acetophenone reduction
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
251
Chain Sequence
MAQYDVAGRSAIVTGGGSGIGRAIALTLAASGAAVLVTDLNEENANAVVAEISAAGGTARALAGDVTDPAFAEASVAAANELAPLRIAVNNAGIGGAAAPVGDYPLDSWRKVIEVNLNAVFYGMQAQLDAIGANGGGAIVNMASILGSVGFANYSAYVTAKHALLGLTQNAALEYAGKNVRVVAVGPGFIRTPLVASNMDADTLAFLEGKHALGRLGEPEEVASLVAFLASDAASFITGSYHLVDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification and characterization of a new carbonyl reductase from Leifsonia xyli HS0904 involved in stereoselective reduction of 3,5-bis(trifluoromethyl)acetophenone
rcsb
molecule keywords Short chain alcohol dehydrogenase
molecule tags Oxidoreductase
source organism Leifsonia xyli
total genus 85
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2020-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...