6XOIA

Structure of sumo1-ml00752641 adduct bound to sae
Total Genus 103

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
337
structure length
311
Chain Sequence
GGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP
5010015020025030030025020015010050
020406080100Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (93-95)EMPTY3H5 (284-286)AH1 (13-26)AH2 (28-36)AH4 (96-102)S1 (38-42)AH3 (46-58)AH9 (262-280)TI4 (103-106)TI2 (79-82)S2 (62-66)TVIII1 (76-79)S3 (70-71)TI1 (72-75)S4 (89-90)S5 (107-111)TIV1 (131-134)TI5 (122-125)TI6 (123-126)AH6 (216-220)S6 (128-132)TIV3 (177-206)S10 (207-212)AH5 (136-149)TII'1 (159-162)S7 (152-159)3H4 (259-261)3H6 (291-293)S8 (162-168)TI7 (288-291)S9 (171-176)TIV2 (169-172)AH7 (227-234)AH8 (238-253)TII1 (83-86)TI3 (90-93)TII2 (86-89)3H3 (120-122)TVIII2 (126-129)AH10 (300-319)3H2 (115-117)Updating...
connected with : NaN
molecule tags Ligase/ligase inhibitor
source organism Homo sapiens
publication title Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
pubmed doi rcsb
molecule keywords SUMO-activating enzyme subunit 1
total genus 103
structure length 311
sequence length 337
ec nomenclature
pdb deposition date 2020-07-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.