6XU6AE

Drosophila melanogaster testis 80s ribosome
Total Genus 31

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
261
structure length
261
Chain Sequence
MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQLGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTVVNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAKTH

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (44-52)TIV6 (79-82)TVIII1 (53-56)AH2 (58-66)S1 (70-72)S2 (88-92)TI'1 (72-75)TIV5 (71-74)S5 (121-128)EMPTYS3 (99-101)TIV8 (94-97)TIV7 (93-96)TVIII2 (92-95)S4 (112-113)TI3 (104-107)TI6 (163-166)TI9 (221-224)S15 (225-230)TIV10 (133-136)TIV9 (132-135)S6 (138-141)TI4 (141-144)S8 (158-163)TIV14 (176-179)S10 (180-183)TII4 (188-191)S12 (197-198)S13 (208-211)TI8 (212-215)S14 (217-220)S16 (233-234)TII1 (10-13)TIV4 (23-26)3H1 (16-18)TI1 (37-40)TI2 (38-41)TII2 (85-88)TIV15 (201-204)TIV16 (239-242)S9 (168-173)AH3 (249-257)3H2 (117-119)Updating...
connected with : NaN
molecule tags Ribosome
publication title Specialisation of ribosomes in gonads through paralog-switching
rcsb
molecule keywords 40S ribosomal protein SA
total genus 31
structure length 261
sequence length 261
ec nomenclature
pdb deposition date 2020-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AE PF00467 KOW KOW motif
AE PF00900 Ribosomal_S4e Ribosomal family S4e
AE PF01479 S4 S4 domain
AE PF08071 RS4NT RS4NT (NUC023) domain
AE PF16121 40S_S4_C 40S ribosomal protein S4 C-terminus
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.