6XU6CX

Drosophila melanogaster testis 80s ribosome
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
120
structure length
120
Chain Sequence
ARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRNRMDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKAYVRLARDYDALDIANKIGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Specialisation of ribosomes in gonads through paralog-switching
rcsb
molecule keywords 40S ribosomal protein SA
molecule tags Ribosome
total genus 13
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2020-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
CX PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...