6XWVA

Crystal structure of drosophila melanogaster cenp-c bound to cal1
Total Genus 26
12801300132013401360138014000510152025
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
137
structure length
133
Chain Sequence
DEQEEASTKLMQWLRGVGDAPPSAENASVSSANELIFYQVDGIDYAFYNTKEKAMLGYMRFKPYQKRSMKQAKVHPLKLLVQFGEFNVETLAVGEEKEVHSVLRVGDMIEIDRGTRYSIQNAIDKVSVLMCIR
12801300132013401360138014001400138013601340132013001280
0510152025Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TII2 (1339-1342)TIV1 (1316-1319)S2 (1320-1324)S4 (1343-1349)TVIII1 (1327-1330)EMPTYTII1 (1329-1332)TII4 (1389-1392)TIV2 (1349-1352)S5 (1354-1360)TII3 (1381-1384)S10 (1404-1409)S8 (1384-1388)S9 (1392-1398)AH1 (1274-1288)S3 (1333-1338)TI1 (1303-1306)S1 (1313-1317)S6 (1363-1368)S7 (1376-1380)3H1 (1309-1311)Updating...
connected with : NaN
molecule tags Cell cycle
source organism Drosophila melanogaster
publication title Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
pubmed doi rcsb
molecule keywords Calmodulin
total genus 26
structure length 133
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2020-01-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.