6XX0C

Crystal structure of nemo in complex with ubv-lin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
76
structure length
76
Chain Sequence
GPMQINVKTLTGTTIGLEVEPSDTIENVKAKIQDKEGIPPDQQILFFSGMQLEDGRTLSDYNIQKESRLYLVFSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hNEMO in complex with Ubv-LIN
rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Inhibitor of kappa light polypeptide gene enhancer in B-cell
total genus 20
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2020-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...