6XX3A

Crystal structure of the c-src sh3 domain h122r-q128e mutant in complex with cu(ii) at ph 6.5 co-crystallized with methyl beta-cyclodextrin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
54
Chain Sequence
SHMTFVALYDYESRTETDLSFKKGERLQIVDWWLARSLTTGETGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The effect of an engineered ATCUN motif on the structure and biophysical properties of the SH3 domain of c-Src tyrosine kinase.
pubmed doi rcsb
molecule tags Protein binding
source organism Gallus gallus
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 54
sequence length 59
ec nomenclature
pdb deposition date 2020-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...