6XYDA

Crystal structure of q4d6q6, a conserved kinetoplastid-specific protein from trypanosoma cruzi
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
106
Chain Sequence
HMPNLCVSATFNPPVITMLGSALREETVKLLEQRIPTGVSVKFLFYPNPDHWRMELSQHFDDLHKSAVFLTIIEGLEGEGWNLRASNSIRDSESGKDTTKLFFARR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of Q4D6Q6, a conserved kinetoplastid-specific protein from Trypanosoma cruzi.
pubmed doi rcsb
source organism Trypanosoma cruzi (strain cl brener)
total genus 28
structure length 106
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2020-01-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...