6XZ5A

Rovc - regulator of virulence interconnected with the csr system
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
245
structure length
214
Chain Sequence
KKLYNDFAWECLRRNPQYISDWELFMKNTLTNGGGIPSELIQSELDLNAEKKWGVMKYIDPYNSDPTNVFWSLKLSNRSVRVKLWGDMSNLPGVKHQRLLMHDNTLCVKIFSQNGYFQLFIXXXXXXXXXXXXXXXXXXXXXXXXXXKEEQYLGLLKTIDDRKQGFSHRDIASEIFGKELVKNEWSADSWVRAKIRYRIKKANALINYGYLNFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Uncharacterized protein,RovC,Uncharacterized protein
publication title RovC - a novel type of hexameric transcriptional activator promoting type VI secretion gene expression
rcsb
source organism Yersinia pseudotuberculosis serotype o:3 (strain ypiii)
total genus 69
structure length 214
sequence length 245
ec nomenclature
pdb deposition date 2020-02-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...