6Y04A

Crystal structure of beta-carbonic anhydrase isoform i (tvaca1) from the trichomonas vaginalis protozoan.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
182
structure length
182
Chain Sequence
MSQLELITSANQAFLEANPELTKLNKAPQRHIAIVTCMDTRLVNFAEDAIGVKRGEATVIKAAGNGIWTTGLSDIVVSLLVSIYELGVQEIFIMGHECCGMTHASTDSLGAQMLKSGIKPEDIEKFKSDLSKWVDDFKDPIDNIKNSVRCVRENPLIPKNIPIHGLLIHPDTGKVTTIINGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterisation of a protozoan beta-carbonic anhydrase fromTrichomonas vaginalis.
pubmed doi rcsb
molecule tags Lyase
source organism Trichomonas vaginalis
molecule keywords Carbonic anhydrase
total genus 55
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2020-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00484 Pro_CA Carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...