6Y2NA

Crystal structure of ribonucleotide reductase r2 subunit solved by serial synchrotron crystallography
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
309
structure length
306
Chain Sequence
GRVDVAEKAMINSRADVNQLLPLKYGWAWEKYLAGCNNHWMPTEVSMQADIALWKSRDGLTDDERMMLKRNLGFFATAESLVANNIVLAVYRHITNPECRQYLLRQAFEEAVHTHTFQYICESLGLDEGELFNMYREIPSISDKDAWALRYTQNLENPIGTPEADQAFLRDLVAFYVIFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDCINQIKIENPHLWTPEFQEEVRTMLTEACELEVAYGRDTMPRGILGLNAGLCEEYMRFITNRRCAQLGLEPVFPETANPFPWM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Current status and future opportunities for serial crystallography at MAX IV Laboratory.
pubmed doi rcsb
molecule keywords Ribonucleoside-diphosphate reductase subunit beta
molecule tags Oxidoreductase
source organism Saccharopolyspora erythraea (strain atcc 11635 / dsm 40517 / jcm 4748 / nbrc 134
total genus 124
structure length 306
sequence length 309
ec nomenclature ec 1.17.4.1: Ribonucleoside-diphosphate reductase.
pdb deposition date 2020-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00268 Ribonuc_red_sm Ribonucleotide reductase, small chain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...