6Y5YA

Structure of new jersey polyomavirus vp1 in complex with 3'-sialyllactose
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
283
structure length
279
Chain Sequence
VLNIIATTEIELWLEPRMGVNAPTGDRKEWYGYSEVIHHADGYDNNLLSVQMPQYSCARVQLPMLNTDMTCETLMMWEAVSCKTEVVGIGSLISVHLLEAKMEAGPNSDGPSRPIEGMNYHMFAVGGEPLDLQGIESNGQTKYATAIPAKSIHPNDIAKLPEEDKAQLQGLVPKAKAKLDKDGFYPVEEWSPDPSRNENSRYYGSFVGGLQTPPNLQFTNAVSTVLLDENGVGPLCKGDGLFVSCADICGVLVKADNEAIRYRGLPRYFKVTLRKRAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis and Evolution of Glycan Receptor Specificities within the Polyomavirus Family
doi rcsb
molecule tags Viral protein
source organism New jersey polyomavirus-2013
molecule keywords VP1
total genus 67
structure length 279
sequence length 283
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2020-02-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...