6YDWBf

55s mammalian mitochondrial ribosome with mtefg1 and two trnamet (ti-post)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
108
structure length
108
Chain Sequence
TYSSLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNIEETHDLVLKTRLEEKGEHLEQGPMIEQLSKMFFTTKHRWYPRGQYHRRRRKPNPPKDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mammalian mitochondrial translation elongation catalyzed by mtEFG1.
pubmed doi rcsb
molecule keywords Uncharacterized protein
molecule tags Translation
source organism Homo sapiens
total genus 12
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2020-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Bf PF10210 MRP-S32 Mitochondrial 28S ribosomal protein S32
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...