6YF6A

Ecla c-terminal domain; sugar-binding protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
140
structure length
140
Chain Sequence
FEDLTNFERDNWNNWQAGPAGHDLYLVDASTRAVEFITRPNKNHAGEILKKTLTGLTAGYEYTWTVKIARIIGKYEAPKVSLRADGKDISAPLELKQANEWVTLSGKFKATGSQAELAVVSHVSASMGNDFRIKELKIKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
publication title EclA C-terminal domain; sugar-binding protein
rcsb
source organism Enterobacter cloacae subsp. cloacae (strain atcc 13047 / dsm 30054 / nbrc 13535
total genus 21
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-03-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...