6YGHA

Duck hepatitis b virus capsid
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
188
structure length
188
Chain Sequence
MDINASRALANVYDLPDDFFPKIDDLVRDAKDALEPYWKSDSIKKHVLIATHFVDLIEDFWQTTQGMHEIAESLRAVIPPTTTPVPPGYLIQHEEAEEIPLGDLFKHQEERIVSFQPDYPITARIHAHLKAYAKINEESLDRARRLLWWHYNCLLWGEAQVTNYISRLRTWLSTPEKYRGRDAPTIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Slowly folding surface extension in the prototypic avian hepatitis B virus capsid governs stability.
pubmed doi rcsb
molecule tags Virus like particle
source organism Hepatitis b virus duck/dhbv-16
molecule keywords Capsid protein
total genus 52
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, H
ec nomenclature
pdb deposition date 2020-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00906 Hepatitis_core Hepatitis core antigen
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...