6YUEA

Fragment of nitrate/nitrite sensor histidine kinase narq (r50s variant)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
227
structure length
227
Chain Sequence
MIVKRPVSASLARAFFYIVLLSILSTGIALLTLASSLRDAEAINIAGSLSMQSYRLGYDLQSGSPQLNAHRQLFQQALHSPVLTNLNVWYVPEAVKTRYAHLNANWLEMNNRLSKGDLPWYQANINNYVNQIDLFVLALQHYAERKMLLVVAISLAGGIGIFTLVFFTLRRIRHQVVAPLNQLVTASQRIEHGQFDSPPLDTNLPNELGLLAKTFNQMSSELHKLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sensor Histidine Kinase NarQ Activates via Helical Rotation, Diagonal Scissoring, and Eventually Piston-Like Shifts.
pubmed doi rcsb
molecule tags Membrane protein
source organism Escherichia coli k-12
molecule keywords Nitrate/nitrite sensor protein NarQ
total genus 93
structure length 227
sequence length 227
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2020-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF13675 PilJ Type IV pili methyl-accepting chemotaxis transducer N-term
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...