6YWYHH

The structure of the mitoribosome from neurospora crassa with bound trna at the p-site
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
160
structure length
160
Chain Sequence
GIQQITNMCSHLQNASRARLGLTSLPNTKYNLALALALHRAGFISSITRGGPHPPTPEALMTYEPEPVTSANVATRRLWVGLKYWNEEPVLKELKPISKPSRLVTASLEQLNRVARGFPAGYMKGLQLGECLFVNTDRGVLEVREAVERKVGGLVLCKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.
pubmed doi rcsb
molecule tags Translation
molecule keywords 23S rRNA
total genus 35
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2020-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
HH PF00410 Ribosomal_S8 Ribosomal protein S8
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...