6Z0JA

Crystal structure of laccase from pediococcus acidilactici pa5930 (tris-hcl ph 8.5)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
461
structure length
461
Chain Sequence
MITKYLYDENAYDYHDGGYRPLKKAPGEEHPLNVPAFLKPDRIEGNEIYYTVTAQAGETKILPGKPTHTWGYNGSILGPAIQFETGKTYHVTLKNELDEVTTFHWHGLNIVGPYEDGGPHAPVYPHGERKITFTVDQPAANIWLHPHPCPETARQVWNGLAAPVIITDGHEQSLKLPRRWGVNDFPVVLQDRSYHDNQLDYKADYDVDGTLGDYALVNGTVNPVVNVTKPIIRLRFLNGSNRREWRLHFADYHPFTQIGSDGGLLPEAVEMDRIMLTCAERADVLVNFSDYQPGQEVILQTDDFNLIKFKIGDIKKENMLLPSPLAEIPALSVDENTPVFKTVMSGMDDQVRLDGKLFDMQRIDTRQQVDQTQIWEVSNTNDMEGGMIHPFHIHGCQFQLIDRNGHAVNPNEHGWKDTIGVNPNETVRIRVKFTKLGIFMYHCHILEHEDTGMMAQIEIFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis and biochemical properties of laccase enzymes from two Pediococcus species.
pubmed doi rcsb
molecule keywords Putative multicopper oxidase mco
molecule tags Oxidoreductase
source organism Pediococcus acidilactici 7_4
total genus 126
structure length 461
sequence length 461
ec nomenclature
pdb deposition date 2020-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...