6Z1PAy

Structure of the mitochondrial ribosome from tetrahymena thermophila
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
190
structure length
190
Chain Sequence
SQTAAVTNKKGNIIGSQQIPFDRWRIVRGDKVVVISGKDQGKTGTVIRVYRKTNRVLVEGINVKLKRVAGNAQDESKGSIHKKIHSIHVSKVSLIDPETGKATRIRFGYLEDGKKIRISTKSGSIIEKPFDHGWKRENRNKNKVDGMLDTPAEKVLQVTYKGEDFDTIKRDFEKYIQEKERKEKLLVFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mitochondrial ribosome from Tetrahymena thermophila
rcsb
molecule tags Ribosome
molecule keywords LSU rRNA_1
total genus 22
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2020-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Ay PF00467 KOW KOW motif
Ay PF17136 ribosomal_L24 Ribosomal proteins 50S L24/mitochondrial 39S L24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...