6Z1PBi

Structure of the mitochondrial ribosome from tetrahymena thermophila
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
715
structure length
626
Chain Sequence
VRNSKAAQHQIRSRNFFEVDPIFPDGKDDESKLYRDFERTKFGSNQRDQRIIFERHTSHMMKRINQSLEREEKIKKLKGRQYKKQKEEVQAIAENVFLDEETKLPYGIGLDDYIELIKEESITTKTGQFYSTLEVICRKIGAYNDVELVKLYQFILAEKVADSQEAKNRAITNIQEKIRFNTNLKRVKQPPRRIDQDDPFFSEESDSESNFSEPLFNFEDKKATVKDLVDPFITQGRKQLETQLIWAKVKQNYYDNKRKFYKEKMYTEEDKSKEVVKKDMTLNVIDFLIDSKDEQEIKTILDKYNLVDEVIPKPEFKEILKNIDYLVDQASTSIKVQIAKEKNQNKDLYFRGNFLQENLKPEDLMWKHFHNNFVSIFPESMPEQEQISQSVQNENDIRFHPKELDIVDYGSSNSKEQENRKRGERDLSKDNQIEIELYRRIKTDPFFRHYIQNEIKYFTERIEDGVLDIAQVIVPADRKNDTPFYYDPTLEDIPLDLIGIKVFASGKRKTSSCLVVIKEGTGKVFVNNEIFYRYFTHSYNRNIALKPMLLSTQYCEYDLHFYVRGGGVMGQSHACQIALARGLTQIHPNLRPIFMKFDLLRTDYRQKERKKTGRYKARKAHTYVRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords LSU rRNA_1
publication title The mitochondrial ribosome from Tetrahymena thermophila
rcsb
total genus 103
structure length 626
sequence length 715
ec nomenclature
pdb deposition date 2020-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Bi PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...