6Z45A

Cdk9-cyclin-t1 complex bound by compound 24
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
324
structure length
313
Chain Sequence
YDDNECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQRVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLFYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLNPNRYNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLAAYVRDPYALDLIDKLLVLDPAQRIDSEDALEHDFFWSDPMPSDLKGML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of AZD4573, a Potent and Selective Inhibitor of CDK9 That Enables Short Duration of Target Engagement for the Treatment of Hematological Malignancies.
pubmed doi rcsb
molecule keywords Cyclin-dependent kinase 9
molecule tags Transferase
source organism Homo sapiens
total genus 88
structure length 313
sequence length 324
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2020-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...