6ZCKC

Coxsackievirus b4 in complex with capsid binder compound 48
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
238
structure length
238
Chain Sequence
b'GLPTMLTPGSTQFLTSDDFQSPSAMPQFDVTPEMNIPGQVRNLMEIAEVDSVVPINNLQANLKTMEAYRVQVRSTDEMGGQIFGFPLQPGASSVLQRTLLGEILNYYTHWSGSLKLTFVFCGSAMATGKFLLAYSPPGAGAPDSRKNAMLGTHVIWDVGLQSSCVLCVPWISQTHYRYVVDDKYTASGFISCWYQTNVIVPAEAQKSCYIMCFVSACNDFSVRMLRDTQFIKQDTFYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Identification of a conserved virion-stabilizing network inside the interprotomer pocket of enteroviruses
rcsb
molecule tags Virus
total genus 30
structure length 238
sequence length 238
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2020-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...