6ZJ9A

Crystal structure of equus ferus caballus glutathione transferase a3-3 in complex with glutathione
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
220
structure length
220
Chain Sequence
VKPMLHYFNGRGRMEPIRWLLAAAGVEFEETFIDTPEDFEKLKNDGSLMFQQVPMVEIDGMKLVQSRAILNYVAAKHNLYGKDIKERALIDMYIEGVADLNEMILLLPITPPAEKDAKIMLIKDRTTNRYLPAFEKVLKSHGEDYLVGNRLSRADIHLVELLYLVEELDPSLLTNFPLLKALKARISNLPTVKKFLQPGGARKPPGDEKSVEKSRKIFKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
source organism Equus caballus
publication title Structural and functional analysis of the inhibition of equine glutathione transferase A3-3 by organotin endocrine disrupting pollutants.
pubmed doi rcsb
molecule keywords Glutathione S-transferase
total genus 80
structure length 220
sequence length 220
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2020-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...