6ZS1A

Chaetomium thermophilum cuzn-superoxide dismutase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
YVEMVKAVAVVRGDSKVTGTVTFEQESESSPTIITWDITGHDPNAKRGMHIHTFGDNTNGCTSAGPHFNPHGKTHGAPTDENRHVGDLGNIETDANGNSKGTMTDHLVKLIGPESVIGRTVVVHAGTDDLGKGGNEESLKTGNAGPRPACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Cu,Zn superoxide dismutase from the thermophilic fungus Chaetomium thermophilum.
pubmed doi rcsb
molecule keywords Superoxide dismutase [Cu-Zn]
molecule tags Metal binding protein
source organism Chaetomium thermophilum var. thermophilum dsm 1495
total genus 43
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2020-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...