6ZX9C

Crystal structure of siv vpr,fused to t4 lysozyme, isolated from moustached monkey, bound to human ddb1 and human dcaf1 (amino acid residues 1046-1396)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
257
structure length
257
Chain Sequence
NIFEMLRIDHGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLAAAMERVPPSHRPPWHSRVVPTTMQQAQQAMWDLNEEAEKHFSREELRGIWNDVTELPADPNWTVDQAAIACAIDYIRRTQTLLFRHYREGCYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SIV Vpr,fused to T4 lysozyme, isolated from moustached monkey, bound to human DDB1 and human DCAF1 (amino acid residues 1046-1396)
rcsb
molecule keywords DNA damage-binding protein 1
molecule tags Viral protein
source organism Homo sapiens
total genus 76
structure length 257
sequence length 257
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2020-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00959 Phage_lysozyme Phage lysozyme
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...