6ZXGf

Cryo-em structure of a late human pre-40s ribosomal subunit - state h1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
57
Chain Sequence
PKKNKHKRKKVKLAVLKYYKVISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the final steps of human 40S ribosome maturation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords pre-18S ribosomal RNA
total genus 5
structure length 57
sequence length 62
ec nomenclature
pdb deposition date 2020-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF00240 ubiquitin Ubiquitin family
f PF01599 Ribosomal_S27 Ribosomal protein S27a
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...