6ZXMA

Diguanylate cyclase dgcr in complex with c-di-gmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
293
structure length
293
Chain Sequence
RKILIIEDSELQRKLLSRWVSKNGYIAIEAESISVAREKIISESIDVVLLDWELPDGNGIDLISDILSTSPVGWLPIIMVTGHTEPEYFKIAIEAGATDYITKPAKEIELLARIFSALRIKALHDQLRETAIRDVMTGLYNRRYMEERIEQEFQRCKRHDSLLSMAMIDIDKFKNINDTYGHEIGDQVIKQLAHELKTSFRKSDIISRFGGEEFVILFPETGVVDATRILDRVRENVSKLEMKSDTDQIFHFTFSGGVAGGDLSDIQSNQELLKIADKNLYEAKSSGRNQIIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DgcR structure in activated state
rcsb
molecule keywords Putative GGDEF/response regulator receiver domain protein
molecule tags Signaling protein
source organism Leptospira biflexa serovar patoc strain 'patoc 1 (paris)'
total genus 85
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2020-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...