6ZYYY

Outer dynein arm-shulin complex - dyh3 motor region (tetrahymena thermophila)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
KLRQRKDLTEEEIVDIQFRNRGEGLENGEFYDGQFWRNIQGLILPHHPKKDEFIEEYLKQEEVRIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Motor protein
molecule keywords Dynein heavy chain, outer arm protein
publication title Shulin packages axonemal outer dynein arms for ciliary targeting.
rcsb
source organism Tetrahymena thermophila (strain sb210)
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2020-08-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...