7E44A

Crystal structure of nudc complexed with dpcoa
Total Genus 69

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
256
structure length
256
Chain Sequence
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQRRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEQSGIKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEY

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS5 (41-49)S1 (2-5)TI1 (6-9)TII1 (38-41)3H2 (33-35)S3 (20-22)S7 (65-66)S4 (30-32)AH1 (76-94)3H3 (68-71)TVIII1 (95-98)S8 (105-108)TI4 (99-102)TI3 (98-101)TIV3 (116-119)S10 (122-123)S9 (113-116)S11 (128-137)TIV5 (195-198)TII'1 (137-140)AH3 (240-255)TI8 (227-230)S12 (140-146)S13 (154-155)S17 (220-227)TII2 (162-165)AH2 (167-179)S15 (182-194)TII3 (236-239)S16 (199-210)TI6 (216-219)S2 (10-17)TIV1 (16-19)3H1 (24-26)TI2 (71-74)TI5 (108-111)S14 (157-160)TIV4 (146-149)S6 (52-58)Updating...
connected with : NaN
publication title Structural insights into dpCoA-RNA decapping by NudC.
pubmed doi rcsb
molecule keywords NADH pyrophosphatase
molecule tags Hydrolase
source organism Escherichia coli bl21(de3)
total genus 69
structure length 256
sequence length 256
chains with identical sequence B, E, F
ec nomenclature ec 3.6.1.22: NAD(+) diphosphatase.
pdb deposition date 2021-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
A PF09297 zf-NADH-PPase NADH pyrophosphatase zinc ribbon domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.