7NNJA

Crystal structure of nudt4 (diphosphoinositol polyphosphate phosphohydrolase 2) in complex with 4-o-bn-1-pcp-insp4 (amr2105)
Total Genus 38

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
138
structure length
131
Chain Sequence
TRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI4 (42-45)TI1 (13-16)TVIII1 (40-43)S5 (73-86)TI3 (39-42)TI7 (87-90)S1 (18-26)S6 (91-103)AH1 (59-71)TI2 (28-31)S2 (33-38)S7 (116-121)TI5 (54-57)S3 (46-47)AH2 (122-132)TIV1 (104-107)TI6 (86-89)S4 (50-52)Updating...
connected with : NaN
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal Structure of NUDT4 (Diphosphoinositol polyphosphate phosphohydrolase 2) in complex with 4-O-Bn-1-PCP-InsP4 (AMR2105)
rcsb
molecule keywords Diphosphoinositol polyphosphate phosphohydrolase 2
total genus 38
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature ec 3.6.1.52: diphosphoinositol-polyphosphate diphosphatase.
pdb deposition date 2021-02-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.