7A0ELLL

The crystal structure of bovine thrombin in complex with hirudin (c6u/c14u) at 1.9 angstroms resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
40
structure length
40
Chain Sequence
PFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diselenide crosslinks for enhanced and simplified oxidative protein folding
doi rcsb
molecule tags Hydrolase
molecule keywords Prothrombin
total genus 9
structure length 40
sequence length 40
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 2020-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
LLL PF09396 Thrombin_light Thrombin light chain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...