7A0RP

50s deinococcus radiodurans ribosome bounded with mycinamicin i
Total Genus 28

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
128
structure length
128
Chain Sequence
ATFRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAEKGN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S3 (116-130)TII1 (22-25)O1 (31-33)S1 (25-31)AH2 (35-45)S2 (90-106)3H1 (87-89)AH4 (64-81)TI1 (81-84)EMPTYTIV1 (45-48)AH3 (50-59)TII3 (109-112)AH1 (11-17)Updating...
connected with : NaN
molecule tags Antibiotic
publication title 50S Deinococcus radiodurans ribosome bounded with mycinamicin I
rcsb
molecule keywords RNA (2730-MER)
total genus 28
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2020-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.