7A4LA

Pre-only solution structure of the iron-sulfur protein pioc from rhodopseudomonas palustris tie-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
VTKKASHKDAGYQESPNGAKRCGTCRQFRPPSSCITVESPISENGWCRLYAGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PioC
publication title PRE-driven Protein NMR Structures: an Alternative Approach in Highly Paramagnetic Systems.
pubmed doi rcsb
source organism Rhodopseudomonas palustris tie-1
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2020-08-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...