7A4P8

Structure of small high-light grown chlorella ohadii photosystem i
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
219
structure length
219
Chain Sequence
ATRPLWQPGVEAPKHLDGTMPGDFGFDPLNLGVNKEALNWYRNAELQNGRWAMLGVAGIVIPAELTRVGVLNVPEWAEAGKVYAESENAIPFASLLMVQLFLFNFVEIKRWEDIKKPGSQAEPGSFLGFESGFKGTGISGYPGGAFNPFGLGNSSKEAMDDLKWREIRNGRLAMVAFLGFLSQHAATGKGPLDNLADHLADPWGANFCSNGVSIPSALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Cryo-EM photosystem I structure reveals adaptation mechanisms to extreme high light in Chlorella ohadii.
pubmed doi rcsb
total genus 59
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2020-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
8 PF00504 Chloroa_b-bind Chlorophyll A-B binding protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...