7A5GO6

Structure of the elongating human mitoribosome bound to mtef-tu.gmppcp and a/t mt-trna
Total Genus 26

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
185
structure length
185
Chain Sequence
KDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TIV1 (52-55)TIV2 (55-58)AH1 (62-68)TIV3 (56-59)TII'1 (68-71)TI3 (72-75)TI4 (74-77)EMPTYTVIII1 (87-90)S2 (99-100)TIV4 (95-98)TI5 (105-108)TI6 (106-109)TI7 (107-110)TI9 (124-127)TI11 (136-139)AH3 (144-160)TI12 (138-141)TVIII2 (93-96)S1 (95-96)TIV6 (101-104)TI10 (128-131)Updating...
connected with : NaN
molecule tags Ribosome
publication title Elongational stalling activates mitoribosome-associated quality control.
pubmed doi rcsb
molecule keywords nascent chain
total genus 26
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2020-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O6 PF01084 Ribosomal_S18 Ribosomal protein S18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.