7A7LA

Rsegfp in the green-off state
Total Genus 62

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
231
structure length
230
Chain Sequence
DPMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVLCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNAYIMADKQKNGIKSNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQNKLSKDPNEKRDHMVLLEFVTAAGIT

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H4 (76-81)AH1 (-1-9)AH2 (83-87)3H1 (37-39)S1 (12-22)S2 (25-36)S6 (118-128)TI1 (48-51)S3 (41-48)EMPTYS11 (217-227)3H2 (57-60)TI2 (60-63)TIV2 (61-64)S5 (105-115)S9 (176-187)TVIa1 (87-90)TI3 (88-91)S4 (92-100)TII1 (100-103)TIV3 (114-117)TI4 (131-134)TI5 (135-138)TIV4 (134-137)TI6 (136-139)3H5 (156-158)S7 (148-155)TI7 (171-174)S10 (199-208)TI8 (210-213)TIV1 (21-24)3H3 (69-71)S8 (160-170)Updating...
connected with : NaN
molecule tags Fluorescent protein
source organism Aequorea victoria
publication title Structure-Function Dataset Reveals Environment Effects within a Fluorescent Protein Model System.
pubmed doi rcsb
molecule keywords Green fluorescent protein
total genus 62
structure length 230
sequence length 231
ec nomenclature
pdb deposition date 2020-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.