7AFDN

Bacterial 30s ribosomal subunit assembly complex state a (head domain)
Total Genus 26

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
100
structure length
100
Chain Sequence
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (53-55)AH1 (4-32)3H2 (57-59)EMPTYTIV1 (33-36)AH2 (39-50)TI2 (65-68)TII1 (70-73)TI4 (75-78)AH3 (82-90)TIV2 (91-94)TII2 (93-96)TI3 (74-77)TI1 (64-67)Updating...
connected with : NaN
molecule tags Ribosome
publication title A conserved rRNA switch is central to decoding site maturation on the small ribosomal subunit.
pubmed doi rcsb
molecule keywords 16SrRNA of the head domain (residue C931 to G1386)
total genus 26
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2020-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00253 Ribosomal_S14 Ribosomal protein S14p/S29e
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.