7ALXAAA

Sav-sod: chimeric streptavidin-csod as host for artificial metalloenzymes
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
157
structure length
123
Chain Sequence
QAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGAGAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWASTLVGHDTFTKVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sav-SOD: Chimeric Streptavidin-cSOD as Host for Artificial Metalloenzymes
rcsb
molecule keywords Streptavidin,Superoxide dismutase [Cu-Zn],Streptavidin
molecule tags Metal binding protein
source organism Streptomyces avidinii
total genus 25
structure length 123
sequence length 157
chains with identical sequence BBB
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2020-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...