7AMCA

Smbrd3(2), bromodomain 2 of the bromodomain 3 protein from schistosoma mansoni in complex with ibet726
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
115
structure length
115
Chain Sequence
LRLSEALKACSNILKDISSQRYRDLNHFFLKPVDVVALGLHDYYDVVKKAMDLSTIKTKLESGQYHTKYDFADDVRLMFNNCYKYNGEDSEVARVGKQLQAIFDENFAKVPDDES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SBM3, Bromodomain 3 from Schistosoma mansoni in complex with iBET726
rcsb
molecule tags Protein binding
source organism Schistosoma mansoni
molecule keywords Putative bromodomain-containing protein 3, brd3
total genus 44
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-10-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...