7AMLA

Ret/gdnf/gfra1 extracellular complex cryo-em structure
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
596
structure length
596
Chain Sequence
GLYFPQRLYTENIYVGQQQGSPLLQVISMREFPTERPYFFLCSHRDAFTSWFHIDEASGVLYLNKTLEWSDFSSLRSGSVRSPKDLTLKVGVSSTPPMKVMCTILPTVEVKLSFINDTAPSCGQVELSTLCFPEKISNPHITENREPGALRQLRRFTHMSICPNYTISYGVVAGSSVPFAVDDSTSELVVTAQVDREEKEVYHLDIVCMVRTERNLEEVFRSLHVNIYDEDDNSPYVNGTDTEDVLVEFDRSEGTVFGTLFVYDRDTTPVYPTNQVQNKLVGTLMTNDSWIKNNFAIEHKFREEKAIFGNVRGTVHEYKLKLSQNLSVTEQRSFLLGYLVNDTTFPGPEGTVLLHFNVTVLPVPIRFSNVTYSFTVSQKATTYSQIGKVCVENCQKFKGIDVTYQLEIVDRNITAEAQSCYWAVSLAQNPNDNTGVLYVNDTKVLRRPECQELEYVVIAQEQQNKLQAKTQLTVSFQGEADSLRTDEPRFPACAEKRQRGDCEATRGLGAPTGRCQWRQGRDKGISKRYSTCSPNLGTCPDGYCDAIESKNISICPQDCSSEAIIGGYERDLYGIKAGHGTCYCFEGKCFCERDEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A two-site flexible clamp mechanism for RET-GDNF-GFRa1 assembly reveals both conformational adaptation and strict geometric spacing
doi rcsb
molecule tags Signaling protein
source organism Danio rerio
molecule keywords Proto-oncogene tyrosine-protein kinase receptor Ret
total genus 51
structure length 596
sequence length 596
chains with identical sequence D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2020-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17756 RET_CLD1 RET Cadherin like domain 1
A PF17812 RET_CLD3 RET Cadherin like domain 3
A PF17813 RET_CLD4 RET Cadherin like domain 4
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...