7AOIBZ

Trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
189
structure length
189
Chain Sequence
RISERAFMDIAIGTKAPRRIVFKLFPRKCPSAVKNFIELCSGNVSTDTYESGNRDKLISESALPQLTYKNSTFHRVEKGYLIQGGDIVTGRGTEQLSIYGGTFSAPEEVRASVFDKPGLVGTASSSPNAHGSQFFILTAKEANHLNGTCICFGQVADGLDVVQEIEQVPIDPSGFPSLKVSIVDCGVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interconnected assembly factors regulate the biogenesis of mitoribosomal large subunit
rcsb
molecule tags Ribosome
molecule keywords bL28m
total genus 33
structure length 189
sequence length 189
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2020-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
BZ PF00160 Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...