7AR9L

Cryo-em structure of polytomella complex-i (membrane arm)
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
536
structure length
536
Chain Sequence
MFLLAVYFLFFSAIANGFFGRYLGVRGSQLLGPSALFLALLCSGTIFYEVCIQGCSTNIKLFENFVYSNELNVSASFLYDPLAATMTLTVVWISCAVHAYQNLYMRGDGSQTLFTSYLSAFTGFMLILVAGQNLVMLFIGWEGIGVCSYLLIGYYGSRVSAVKSANKSLIVNKISDGFLLGSMLYLWFYTGSFSYCSLATFQIPDVVSILVLLGAIGKSSQLFFHVWLADAMEGPTPVSALIHAATLVTAGIYVLCKLNLHSQSAVGILGAATALMGGLFGLAANDLKRVIAFSTCSQLGYMMAVLSTCDDGADFAMGHLVSHAGFKATLFLSAGLSIAKENNNFLNRYGSRQGSPTLSFATTIASLNLLGFPELGGFYSKESILNNAYINQGVSIILTLATFLTAFYTSKVLAQLYLFPYGNGRQQKSFDIDATTLICFGLLLSEMLLRIFTGSSLSQNMTTNLPAHIKNLPFWVALSGALSGLATTNLFSSNFMRFFGNRGGFDVFYARKCSNVFYHNAYVSYTLLDRGFLKLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
pubmed doi rcsb
molecule keywords ND3
molecule tags Electron transport
total genus 201
structure length 536
sequence length 536
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2020-10-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...