7AS8P

Bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
146
Chain Sequence
MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGFEGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETGVISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
pubmed doi rcsb
molecule tags Translation
source organism Bacillus subtilis (strain 168)
molecule keywords Rqc2 homolog RqcH
total genus 15
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2020-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...