7AS9L

Bacillus subtilis ribosome-associated quality control complex state a. ribosomal 50s subunit with peptidyl trna in the a/p position and rqch.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
113
Chain Sequence
IETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVEFKVYKNTMTRRAVEQNDFLTGPNAIAFSTPAKVLNDFAKNHEALEIKAGVIEGKVSTVEEVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Bacterial Ribosome-Associated Quality Control by RqcH and RqcP.
pubmed doi rcsb
molecule tags Translation
source organism Bacillus subtilis (strain 168)
molecule keywords Rqc2 homolog RqcH
total genus 33
structure length 113
sequence length 124
ec nomenclature
pdb deposition date 2020-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00466 Ribosomal_L10 Ribosomal protein L10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...