7AZQA

Crystal structure of the iron/manganese cambialistic superoxide dismutase from rhodobacter capsulatus complex with fe
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
199
structure length
199
Chain Sequence
AFELPALPYAHDALASLGMSKETLEYHHDLHHKAYVDNGNKLIAGTEWEGKSVEEIVKGTYCAGAVAQSGIFNNASQHWNHAQFWEMMGPGEDKKMPGALEKALVESFGSVAKFKEDFAAAGAGQFGSGWAWLVKDSDGALKITKTENGVNPLCFGQTALLGCDVWEHSYYIDFRNKRPAYLTNFLDKLVNWENVASRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the cambialistic superoxide dismutase from Rhodobacter capsulatus.
rcsb
molecule keywords Superoxide dismutase [Fe]
molecule tags Oxidoreductase
source organism Rhodobacter capsulatus
total genus 66
structure length 199
sequence length 199
chains with identical sequence E
ec nomenclature ec 1.15.1.1: superoxide dismutase.
pdb deposition date 2020-11-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...