7B1GE

Trpc4 in complex with calmodulin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
64
structure length
48
Chain Sequence
EEIREAFRVFDGYISAAELRHVMTNLGETDEEVDEMIRNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of TRPC4 regulation by calmodulin and pharmacological agents.
pubmed doi rcsb
molecule keywords Transient receptor potential cation channel subfamily c memb
molecule tags Transport protein
source organism Danio rerio
total genus 5
structure length 48
sequence length 64
ec nomenclature
pdb deposition date 2020-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...