7B22A

Vibrio cholerae pard2 antitoxin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
49
structure length
49
Chain Sequence
KNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Antitoxin ParD
publication title Entropic pressure controls the oligomerization of the Vibrio cholerae ParD2 antitoxin.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
total genus 17
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2020-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03693 ParD_antitoxin Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...