7B4PAAA

A bacteroidetes bacterium cuzn-superoxide dismutase with cuzn metalation
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
151
structure length
151
Chain Sequence
EGKTQKAVCVIYPTQDYKVTGVITFTKSDDGVKVVADLNGLSPGKHGFHIHECGDCSASDGTSAGGHFNPEEKSHGAPMDMSRHIGDLGNITADENGKAHLEYIDKMIVFEGEHSIIGRSMIVHKNEDDLKTQPTGNAGARVACGVIGIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Bacterial evolutionary precursors of eukaryotic copper-zinc superoxide dismutases.
pubmed doi rcsb
source organism Bacteroidetes bacterium gwa2_30_7
total genus 33
structure length 151
sequence length 151
chains with identical sequence BBB, CCC, DDD
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2020-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
AAA PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...