7B6EA

Drosophila melanogaster trapp c8 subunits region 355 to 661
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
307
structure length
269
Chain Sequence
DNLRHFVQDYAVRALIPYIEHLVAILAEGVTAELQTRKLGDLYFMFGHYNLAFQSYHQAKRDFNADSAWQYYAGALEMAALSAFMLGTAQRKTYDYMEDAIVCYLTVCKLQQFATRATLLSMECLKTARLYSEVAKQLIRMTNEESDLRSALLLEQAAYCFLVTQPPMHRKYAFHIVLAGNRYSRAGQRKHAYRCYRQAYQVFQKREWSLAEDHIQYTVAKQAYMLKQLEEASRSFAHLLRPGSLQSAQQQTSFLKEYIQTQNELVKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of metazoan TRAPPIII, the multi-subunit complex that activates the GTPase Rab1
doi rcsb
molecule keywords FI18195p1
molecule tags Exocytosis
source organism Drosophila melanogaster
total genus 95
structure length 269
sequence length 307
ec nomenclature
pdb deposition date 2020-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12739 TRAPPC-Trs85 ER-Golgi trafficking TRAPP I complex 85 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...