7B6FA

Gsk3-beta in complex with compound (s)-5c
Total Genus 99

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
347
structure length
346
Chain Sequence
KVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (75-78)TI1 (65-68)S1 (37-44)TVIII1 (44-47)S2 (52-65)S3 (68-75)S6 (127-133)AH1 (96-102)TI2 (76-79)S4 (81-88)TI4 (106-109)S5 (112-118)TIV2 (120-123)TI10 (306-309)TIV3 (122-125)TIV7 (322-325)3H3 (325-327)S7 (137-138)TI7 (201-204)AH2 (139-149)TIV4 (179-182)S10 (195-198)AH3 (155-175)AH9 (311-320)S8 (177-178)3H1 (184-186)S11 (205-206)S9 (187-190)TII1 (208-211)TI5 (190-193)TI6 (191-194)AH5 (236-252)TIV6 (286-289)3H2 (220-222)AH4 (225-229)AH6 (262-273)TI8 (285-288)AH7 (278-284)TI9 (288-291)TI11 (345-348)AH10 (331-336)3H4 (338-344)TI3 (90-93)TVIII2 (91-94)TIV5 (231-234)TVIII3 (255-258)AH8 (301-304)Updating...
connected with : NaN
molecule tags Transferase
source organism Homo sapiens
publication title GSK3-beta in complex with compound (S)-5c
rcsb
molecule keywords Glycogen synthase kinase-3 beta
total genus 99
structure length 346
sequence length 347
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2020-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.